PDB entry 2edk

View 2edk on RCSB PDB site
Description: Solution structure of the third ig-like domain from human Myosin-binding protein C, fast-type
Class: contractile protein
Keywords: Ig fold, Fast MyBP-C, C-protein, skeletal muscle fast-isoform, MYBPCF, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2007-02-14, released 2007-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, fast-type
    Species: Homo sapiens [TaxId:9606]
    Gene: Mybpc2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14324 (7-100)
      • cloning artifact (0-6)
      • see remark 999 (43)
    Domains in SCOPe 2.06: d2edka1, d2edka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2edkA (A:)
    gssgssgpvlivtpledqqvfvgdrvemavevseegaqvmwmkngveltredsfkaryrf
    kkdgkrhilifsdvvqedrgryqvitnggqceaeliveekq