PDB entry 2edh

View 2edh on RCSB PDB site
Description: Solution structure of the PDZ domain (3614- 3713 ) from human obscurin
Class: contractile protein
Keywords: Obscurin-myosin light chain kinase, Obscurin-MLCK, Obscurin-RhoGEF, IG-fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2007-02-14, released 2007-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Obscurin
  Species: Homo sapiens [TaxId:9606]
  Gene: OBSCN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5VST9 (7-106)
    • cloning artifact (0-6)
    • cloning artifact (107-112)
  Domains in SCOPe 2.06: d2edha1, d2edha2, d2edha3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2edhA (A:)
  gssgssgrtsamltvralpikfteglrneeategatavlrcelskmapvewwkghetlrd
  gdrhslrqdgarcelqirglvaedageylcmcgkertsamltvrampsgpssg