PDB entry 2ecz

View 2ecz on RCSB PDB site
Description: Solution structure of the SH3 domain of Sorbin and SH3 domain-containing protein 1
Class: signaling protein
Keywords: Glycoprotein, Membrane, Nuclear protein, Phosphorylation, Polymorphism, SH3 domain, Transport, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-14, released 2008-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sorbin and SH3 domain-containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: SORBS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BX66 (7-63)
    • expression tag (0-6)
    • expression tag (64-69)
  Domains in SCOPe 2.06: d2ecza1, d2ecza2, d2ecza3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eczA (A:)
  gssgssggeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpity
  vdvisgpssg