PDB entry 2eco

View 2eco on RCSB PDB site
Description: Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase Complexed with 4-methylvalerate
Class: transferase
Keywords: PLP-dependent, TRANSFERASE
Deposited on 2007-02-13, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-acetylserine (Thiol)-lyase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ecoa_
  • Heterogens: PLP, 4MV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ecoA (A:)
    mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
    sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
    laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
    tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
    weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
    yaep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ecoA (A:)
    mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
    sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
    laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
    tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
    weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
    ya