PDB entry 2ebn

View 2ebn on RCSB PDB site
Description: crystal structure of endo-beta-n-acetylglucosaminidase f1, an alpha(slash)beta-barrel enzyme adapted for a complex substrate
Deposited on 1994-08-30, released 1995-01-26
The last revision prior to the SCOP 1.59 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2ebn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ebn_ (-)
    ttkaniklfsftevndtnplnnlnftlknsgkplvdmvvlfsaninydaandkvfvsnnp
    nvqhlltnrakylkplqdkgikvilsilgnhdrsgianlstarakafaqelkntcdlynl
    dgvffddeysayqtpppsgfvtpsnnaaarlayetkqampnklvtvyvysrtssfptavd
    gvnagsyvdyaihdyggsydlatnypglaksgmvmssqefnqgryataqalrnivtkgyg
    ghmifamdpnrsnftsgqlpalkliakelygdelvysntpyskdw