PDB entry 2ebk

View 2ebk on RCSB PDB site
Description: Solution structure of the RWD domain of human RWD domain containing protein 3
Class: structural genomics, unknown function
Keywords: RWD domain, alpha+beta sandwich fold, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2007-02-09, released 2007-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RWD domain-containing protein 3
  Species: Homo sapiens [TaxId:9606]
  Gene: RWDD3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y3V2 (7-127)
    • cloning artifact (0-6)
  Domains in SCOPe 2.06: d2ebka1, d2ebka2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ebkA (A:)
  gssgssgmaepvqeelsvlaaifcrphewevlsrsetdgtvfrihtkaegfmdadiplel
  vfhlpvnypsclpgisinseqltraqcvtvkeklleqaesllsepmvhelvlwiqqnlrh
  ilsqpetg