PDB entry 2eba

View 2eba on RCSB PDB site
Description: Crystal structure of the putative glutaryl-CoA dehydrogenase from thermus thermophilus
Class: oxidoreductase
Keywords: glutaryl-CoA dehydrogenase, thermus thermophilius, FAD, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2007-02-07, released 2007-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.26
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative glutaryl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebaa1, d2ebaa2
  • Chain 'C':
    Compound: Putative glutaryl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebac1, d2ebac2
  • Chain 'D':
    Compound: Putative glutaryl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebad1, d2ebad2
  • Chain 'E':
    Compound: Putative glutaryl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebae1, d2ebae2
  • Chain 'F':
    Compound: Putative glutaryl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebaf1, d2ebaf2
  • Chain 'G':
    Compound: Putative glutaryl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebag1, d2ebag2
  • Chain 'H':
    Compound: Putative glutaryl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebah1, d2ebah2
  • Chain 'I':
    Compound: Putative glutaryl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebai1, d2ebai2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ebaA (A:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
    ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplsc
    ltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglll
    awrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnlet
    vytyegthdvhtlvlgreitglnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebaA (A:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
    gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplscltqar
    fgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglllawrla
    rlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnletvytye
    gthdvhtlvlgreitglnaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ebaC (C:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
    ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplsc
    ltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglll
    awrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnlet
    vytyegthdvhtlvlgreitglnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebaC (C:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
    gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplscltqar
    fgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglllawrla
    rlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnletvytye
    gthdvhtlvlgreitglnaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ebaD (D:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
    ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplsc
    ltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglll
    awrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnlet
    vytyegthdvhtlvlgreitglnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebaD (D:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
    gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplscltqar
    fgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglllawrla
    rlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnletvytye
    gthdvhtlvlgreitglnaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ebaE (E:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
    ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplsc
    ltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglll
    awrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnlet
    vytyegthdvhtlvlgreitglnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebaE (E:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
    gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplscltqar
    fgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglllawrla
    rlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnletvytye
    gthdvhtlvlgreitglnaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ebaF (F:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
    ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplsc
    ltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglll
    awrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnlet
    vytyegthdvhtlvlgreitglnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebaF (F:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
    gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplscltqar
    fgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglllawrla
    rlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnletvytye
    gthdvhtlvlgreitglnaf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ebaG (G:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
    ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplsc
    ltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglll
    awrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnlet
    vytyegthdvhtlvlgreitglnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebaG (G:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
    gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplscltqar
    fgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglllawrla
    rlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnletvytye
    gthdvhtlvlgreitglnaf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ebaH (H:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
    ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplsc
    ltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglll
    awrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnlet
    vytyegthdvhtlvlgreitglnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebaH (H:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
    gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplscltqar
    fgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglllawrla
    rlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnletvytye
    gthdvhtlvlgreitglnaf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ebaI (I:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
    ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplsc
    ltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglll
    awrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnlet
    vytyegthdvhtlvlgreitglnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebaI (I:)
    mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
    lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
    argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
    gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalglkaplscltqar
    fgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlawhteglllawrla
    rlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhairhmlnletvytye
    gthdvhtlvlgreitglnaf