PDB entry 2e9s

View 2e9s on RCSB PDB site
Description: human neuronal Rab6B in three intermediate forms
Class: protein transport
Keywords: human neuron, Rab6B, GDP MG NO3 complex, GDP MG complex, GDP complex, PROTEIN TRANSPORT
Deposited on 2007-01-26, released 2008-01-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.199
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-6B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRW1 (1-162)
      • expression tag (163-164)
    Domains in SCOPe 2.05: d2e9sa_
  • Chain 'B':
    Compound: Ras-related protein Rab-6B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRW1 (1-162)
      • expression tag (163-164)
    Domains in SCOPe 2.05: d2e9sb_
  • Chain 'C':
    Compound: Ras-related protein Rab-6B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRW1 (Start-162)
      • expression tag (163-164)
    Domains in SCOPe 2.05: d2e9sc_
  • Heterogens: NO3, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e9sA (A:)
    gkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtag
    qerfrslipsyirdstvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdla
    dkrqitieegeqrakelsvmfietsaktgynvkqlfrrvasallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e9sA (A:)
    kfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagq
    erfrslipsyirdstvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdlad
    krqitieegeqrakelsvmfietsaktgynvkqlfrrvasalle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e9sB (B:)
    gkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtag
    qerfrslipsyirdstvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdla
    dkrqitieegeqrakelsvmfietsaktgynvkqlfrrvasallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e9sB (B:)
    kfklvflgeqsvgktslitrfmydsfdndflsktmyledrtvrlqlwdtaslipsyirds
    tvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdladkrqitieegeqrak
    elsvmfietsaktgynvkqlfrrvasalle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e9sC (C:)
    gkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtag
    qerfrslipsyirdstvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdla
    dkrqitieegeqrakelsvmfietsaktgynvkqlfrrvasallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e9sC (C:)
    fklvflgeqsvgktslitrfmydsfdntflsktmyledrtvrlqlwdtagqerfslipsy
    irdstvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdladkrqitieege
    qrakelsvmfietsaktgynvkqlfrrvasalle