PDB entry 2e9k

View 2e9k on RCSB PDB site
Description: Solution structure of the CH domain from human MICAL-2
Class: structural protein
Keywords: CH domain, all-alpha, actin binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2007-01-25, released 2007-07-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein MICAL-2
    Species: Homo sapiens [TaxId:9606]
    Gene: MICAL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94851 (7-120)
      • cloning artifact (0-6)
    Domains in SCOPe 2.05: d2e9ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e9kA (A:)
    gssgssgdirpsklltwcqqqtegyqhvnvtdlttswrsglalcaiihrfrpelinfdsl
    neddavennqlafdvaerefgippvttgkemasaqepdklsmvmylskfyelfrgtplrp
    v