PDB entry 2e9j

View 2e9j on RCSB PDB site
Description: Solution structure of the 14th filamin domain from human Filamin-B
Class: structural protein
Keywords: beta-sandwich, immunoglobulin-like fold, filamin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2007-01-25, released 2007-07-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Filamin-B
  Species: Homo sapiens [TaxId:9606]
  Gene: FLNB
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75369 (7-118)
    • cloning artifact (0-6)
  Domains in SCOPe 2.05: d2e9ja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2e9jA (A:)
  gssgssgrspfkvkvlptydaskvtasgpglssygvpaslpvdfaidardagegllavqi
  tdqegkpkraivhdnkdgtyavtyipdktgrymigvtyggddiplspyriratqtgdas