PDB entry 2e81

View 2e81 on RCSB PDB site
Description: Cytochrome c Nitrite Reductase from Wolinella succinogenes with bound intermediate hydroxylamine
Class: oxidoreductase
Keywords: multiheme cytochrome, nitrite reductase, reaction intermediate
Deposited on 2007-01-15, released 2007-01-30
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-552
    Species: Wolinella succinogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e81a1
  • Heterogens: CA, YT3, HEM, HOA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e81A (A:)
    sninerekervalnktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpa
    lvvawagypfskdynaprghyyalqdnintlrtgapvdgktgplpsacwtckspdvprii
    eqdgeleyftgkwakygdeivntigcynchddksaelkskvpyldrglsaagfktfaest
    hqekrslvcaqchveyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfad
    wthgisktpmlkaqhpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnm
    dkscmnchreseqklkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkei
    rthirhaqwradmaiaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyva
    pdfetkekaqklakvdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyy
    dktkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e81A (A:)
    ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
    naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
    kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
    eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
    hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
    lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
    iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
    vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk