PDB entry 2e7x

View 2e7x on RCSB PDB site
Description: Structure of the Lrp/AsnC like transcriptional regulator from Sulfolobus tokodaii 7 complexed with its cognate ligand
Class: transcription regulator
Keywords: Transcriptional reggulator, Lrp/AsnC, ST1022, Gln binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION REGULATOR
Deposited on 2007-01-15, released 2008-01-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 150aa long hypothetical transcriptional regulator
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST1022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2e7xa1, d2e7xa2
  • Heterogens: MG, GLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2e7xA (A:)
mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
ervmsipevertstqvvvkiikespnivif