PDB entry 2e7h

View 2e7h on RCSB PDB site
Description: Solution structure of the second fn3 domain from human Ephrin type-B receptor 4
Class: transferase, signaling protein
Keywords: FN3 domain, Ephrin type-B receptor 4 precursor, Tyrosine-protein kinase receptor HTK, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE, SIGNALING PROTEIN
Deposited on 2007-01-10, released 2007-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-B receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHB4, HTK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54760 (7-102)
      • cloning artifact (0-6)
      • cloning artifact (103-108)
    Domains in SCOPe 2.06: d2e7ha1, d2e7ha2, d2e7ha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e7hA (A:)
    gssgssgppavsdirvtrsspsslslawavprapsgavldyevkyhekgaegpssvrflk
    tsenraelrglkrgasylvqvrarseagygpfgqehhsqtqldsgpssg