PDB entry 2e7g

View 2e7g on RCSB PDB site
Description: Solution structure of putative ribosome-binding factor A (RbfA) from human mutochondrial precursor
Class: structural genomics, unknown function
Keywords: RbfA, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2007-01-09, released 2007-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ribosome-binding factor A
    Species: Homo sapiens [TaxId:9606]
    Gene: C18orf22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N0V3 (7-122)
      • cloning artifact (0-6)
      • see remark 999 (43)
      • cloning artifact (123-128)
    Domains in SCOPe 2.07: d2e7ga1, d2e7ga2, d2e7ga3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e7gA (A:)
    gssgssgrkedharlralngllykaltdllctpevsqelydlnvelskvsltpdfsacra
    ywkttlsaeqnahmeavlqrsaahmrhllmsqqtlrnvppivfvqdkgnaalaeldqlla
    vadsgpssg