PDB entry 2e7b

View 2e7b on RCSB PDB site
Description: Solution structure of the 6th Ig-like domain from human KIAA1556
Class: structural protein
Keywords: Ig-like domain, Obscurin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2007-01-09, released 2007-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Obscurin
  Species: Homo sapiens [TaxId:9606]
  Gene: OBSCN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8NHN3 (7-96)
    • cloning artifact (0-6)
    • cloning artifact (97-102)
  Domains in SCOPe 2.07: d2e7ba1, d2e7ba2, d2e7ba3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2e7bA (A:)
  gssgssgpvrfqealkdlevleggaatlrcvlssvaapvkwcygnnvlrpgdkyslrqeg
  amlelvvrnlrpqdsgryscsfgdqttsatltvtalpsgpssg