PDB entry 2e6p

View 2e6p on RCSB PDB site
Description: Solution structure of the Ig-like domain (714-804) from human Obscurin-like protein 1
Class: structural protein
Keywords: Ig-like domain, Obscurin-like protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2006-12-28, released 2007-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Obscurin-like protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: OBSL1, KIAA0657
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75147 (7-97)
    • cloning artifact (0-6)
    • cloning artifact (98-103)
  Domains in SCOPe 2.07: d2e6pa1, d2e6pa2, d2e6pa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2e6pA (A:)
  gssgssgpvhilspqdkvsltfttservvltcelsrvdfpatwykdgqkveesellvvkm
  dgrkhrlilpeakvqdsgefecrtegvsaffgvtvqdpsgpssg