PDB entry 2e5i

View 2e5i on RCSB PDB site
Description: Solution structure of RNA binding domain 2 in Heterogeneous nuclear ribonucleoprotein L-like
Class: gene regulation
Keywords: RRM domain, RBD, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2006-12-21, released 2007-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterogeneous nuclear ribonucleoprotein L-like
    Species: Mus musculus [TaxId:10090]
    Gene: Hnrpll
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q921F4 (7-123)
      • cloning artifact (0-6)
    Domains in SCOPe 2.07: d2e5ia1, d2e5ia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e5iA (A:)
    gssgssgkritrpgntddpsggnkvlllsiqnplypitvdvlytvcnpvgkvqrivifkr
    ngiqamvefesvlcaqkakaalngadiyagcctlkieyarptrlnvirndndswdytkpy
    lgrr