PDB entry 2e4q

View 2e4q on RCSB PDB site
Description: Crystal structure of BphA3 (reduced form)
Class: electron transport
Keywords: Rieske type [2Fe-2S]cluster, ELECTRON TRANSPORT
Deposited on 2006-12-15, released 2007-10-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biphenyl dioxygenase ferredoxin subunit
    Species: Pseudomonas sp. [TaxId:306]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2e4qa_
  • Chain 'C':
    Compound: Biphenyl dioxygenase ferredoxin subunit
    Species: Pseudomonas sp. [TaxId:306]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2e4qc_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e4qA (A:)
    mtftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdv
    vecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4qA (A:)
    tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
    ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e4qC (C:)
    mtftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdv
    vecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4qC (C:)
    tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
    ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalh