PDB entry 2e4p

View 2e4p on RCSB PDB site
Description: Crystal structure of BphA3 (oxidized form)
Class: electron transport
Keywords: Rieske type [2Fe-2S]cluster, ELECTRON TRANSPORT
Deposited on 2006-12-15, released 2007-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biphenyl dioxygenase ferredoxin subunit
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e4pa_
  • Chain 'B':
    Compound: Biphenyl dioxygenase ferredoxin subunit
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e4pb_
  • Heterogens: SO4, FES, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e4pA (A:)
    mtftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdv
    vecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4pA (A:)
    tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
    ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e4pB (B:)
    mtftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdv
    vecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4pB (B:)
    tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
    ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha