PDB entry 2e3x

View 2e3x on RCSB PDB site
Description: Crystal structure of Russell's viper venom metalloproteinase
Class: hydrolase, blood clotting, toxin
Keywords: disintegrin, metalloproteinase, C-type lectin, HYDROLASE, BLOOD CLOTTING, TOXIN
Deposited on 2006-11-30, released 2007-12-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.218
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor X-activating enzyme heavy chain
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7LZ61
      • see remark 999 (126)
  • Chain 'B':
    Compound: Coagulation factor X-activating enzyme light chain 2
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2e3xb_
  • Chain 'C':
    Compound: Coagulation factor X-activating enzyme light chain 1
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2e3xc_
  • Heterogens: NAG, ZN, CA, GM6

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e3xB (B:)
    ldcppdsslyryfcyrvfkehktweaaerfcmehpnnghlvsiesmeeaefvakllsntt
    gkfithfwiglmikdkeqecssewsdgssvsydklgkqefrkcfvlekesgyrmwfnrnc
    eerylfvckvppec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e3xB (B:)
    dcppdsslyryfcyrvfkehktweaaerfcmehpnnghlvsiesmeeaefvakllsnttt
    hfwiglmikdkeqecssewsdgssvsydklgkqefrkcfvlekesgyrmwfnrnceeryl
    fvckvppec
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e3xC (C:)
    ldcpsgwlsyeqhcykgfndlknwtdaekfcteqkkgshlvslhsreeekfvvnlisenl
    eypatwiglgnmwkdcrmewsdrgnvkykalaeesyclimithekvwksmtcnfiapvvc
    kf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e3xC (C:)
    dcpsgwlsyeqhcykgfndlknwtdaekfcteqkkgshlvslhsreeekfvvnlisenle
    ypatwiglgnmwkdcrmewsdrgnvkykalaeesyclimithekvwksmtcnfiapvvck