PDB entry 2e37

View 2e37 on RCSB PDB site
Description: Structure of TT0471 protein from Thermus thermophilus
Class: oxidoreductase
Keywords: NAD/NADp binding dehydrogenase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2006-11-21, released 2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e37a1, d2e37a2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e37b1, d2e37b2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e37c1, d2e37c2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e37d1, d2e37d2
  • Chain 'E':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e37e1, d2e37e2
  • Chain 'F':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e37f1, d2e37f2
  • Chain 'G':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e37g1, d2e37g2
  • Chain 'H':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e37h1, d2e37h2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e37A (A:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e37A (A:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaearalspedraridegvrraayriiegkgatyygigaglarlvrai
    ltdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilk
    eaafalgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e37B (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e37B (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvarlqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqva
    yrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvg
    gvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvrailtde
    kgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilkeaaf
    algf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e37C (C:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e37D (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e37D (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvarlqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqva
    yrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvg
    gvpllefaearalspedraridegvrraayriiegkgatyygigaglarlvrailtdekg
    vytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilkeaafal
    gf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2e37E (E:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e37E (E:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaespedraridegvrraayriiegkgatyygigaglarlvrailtde
    kgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilkeaaf
    algf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2e37F (F:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e37F (F:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaearalspedraridegvrraayriiegkgatyygigaglarlvrai
    ltdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilk
    eaafalgf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e37G (G:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2e37H (H:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e37H (H:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaearalspedraridegvrraayriiegkgatyygigaglarlvrai
    ltdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilk
    eaafalgf