PDB entry 2e35

View 2e35 on RCSB PDB site
Description: the minimized average structure of L11 with rg refinement
Class: RNA binding protein
Keywords: L11, rg, energy-minimized average structure, RNA BINDING PROTEIN
Deposited on 2006-11-20, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2e35a1, d2e35a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e35A (A:)
    mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
    adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
    eaaarmiagsarsmgvevvgapevkda