PDB entry 2e2y

View 2e2y on RCSB PDB site
Description: Crystal Structure of F43W/H64D/V68I Myoglobin
Class: oxygen storage/transport
Keywords: Oxygen Storage/Transport, OXYGEN STORAGE-TRANSPORT complex
Deposited on 2006-11-18, released 2007-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0KIY8 (0-153)
      • engineered (43)
      • engineered (64)
      • engineered (68)
      • engineered (122)
    Domains in SCOPe 2.06: d2e2ya_
  • Heterogens: SO4, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e2yA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekwdrfkhlkteaemkase
    dlkkdgvtiltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg