PDB entry 2e27

View 2e27 on RCSB PDB site
Description: Crystal structure of Fv fragment of anti-ciguatoxin antibody complexed with ABC-ring of ciguatoxin
Class: immune system
Keywords: Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2006-11-08, released 2007-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-ciguatoxin antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2E27
    Domains in SCOPe 2.07: d2e27h_
  • Chain 'L':
    Compound: anti-ciguatoxin antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2E27
    Domains in SCOPe 2.07: d2e27l_
  • Heterogens: AB0, DMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2e27H (H:)
    maqvqllesgaelarpgasvklsckasgytfttywmqwvrqrpgqglewigaiypgngdt
    rysqkfkgkatltadtssstasmqlsslasedsavyycarsdyggdywgqgtsvtvssag
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e27H (H:)
    qvqllesgaelarpgasvklsckasgytfttywmqwvrqrpgqglewigaiypgngdtry
    sqkfkgkatltadtssstasmqlsslasedsavyycarsdyggdywgqgtsvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2e27L (L:)
    madiqmtqspsslsaslggkvtitckanqdikkkiawyqhkpgkgprlliyytstlksgi
    ssrfsgsgsgrdysfsisnlepedaatyyclqydnftwtfgggtkleikraaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e27L (L:)
    iqmtqspsslsaslggkvtitckanqdikkkiawyqhkpgkgprlliyytstlksgissr
    fsgsgsgrdysfsisnlepedaatyyclqydnftwtfgggtkleikr