PDB entry 2e24

View 2e24 on RCSB PDB site
Description: crystal structure of a mutant (R612A) of xanthan lyase
Class: lyase
Keywords: xanthan, polysaccharide lyase, LYASE
Deposited on 2006-11-07, released 2007-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.175
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xanthan lyase
    Species: Bacillus sp. [TaxId:84635]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AQS0 (0-751)
      • engineered (586)
    Domains in SCOPe 2.06: d2e24a1, d2e24a2, d2e24a3
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e24A (A:)
    sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
    gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
    nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
    avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
    lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
    vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
    apnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdl
    aqysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynl
    sarkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaq
    tltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnapatpstavtrnye
    tmwidhgtnpsgasygyvllpnktsaqvgayaadpaieivvntsgvqsvkektlglvgan
    fwtdttqtadlitsnkkasvmtreiaderleasvsdptqanngtiaielarsaegysadp
    gitvtqlaptikftvnvngakgksfhasfqlg