PDB entry 2e22

View 2e22 on RCSB PDB site
Description: Crystal structure of xanthan lyase in complex with mannose
Class: lyase
Keywords: xanthan, mannose, polysaccharide lyase, LYASE
Deposited on 2006-11-07, released 2007-01-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.165
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xanthan lyase
    Species: Bacillus sp. [TaxId:84635]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2e22a1, d2e22a2, d2e22a3
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e22A (A:)
    sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
    gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
    nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
    avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
    lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
    vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
    apnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdl
    aqysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynl
    sarkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaq
    tltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnye
    tmwidhgtnpsgasygyvllpnktsaqvgayaadpaieivvntsgvqsvkektlglvgan
    fwtdttqtadlitsnkkasvmtreiaderleasvsdptqanngtiaielarsaegysadp
    gitvtqlaptikftvnvngakgksfhasfqlg