PDB entry 2e1r

View 2e1r on RCSB PDB site
Description: Structure of eEF2 in complex with a sordarin derivative
Class: translation
Keywords: protein-ligand complex, G-protein, TRANSLATION
Deposited on 2006-10-27, released 2006-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2008-08-12, with a file datestamp of 2008-08-08.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.22
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e1rA (A:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e1rA (A:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakergitiksta
    islysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtieg
    vcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyad
    evlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpkt
    kkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdl
    egkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdp
    kadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrv
    vlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvave
    vknandlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvpl
    kisppvvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfka
    rarimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkeg
    pifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiq
    cpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafp
    qmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl