PDB entry 2dzd

View 2dzd on RCSB PDB site
Description: Crystal structure of the biotin carboxylase domain of pyruvate carboxylase
Class: ligase
Keywords: biotin carboxylase, pyruvate carboxylase, bacillus thermodenitrificans, LIGASE
Deposited on 2006-09-27, released 2007-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate carboxylase
    Species: Geobacillus thermodenitrificans [TaxId:33940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dzda1, d2dzda2, d2dzda3
  • Chain 'B':
    Compound: pyruvate carboxylase
    Species: Geobacillus thermodenitrificans [TaxId:33940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dzdb1, d2dzdb2, d2dzdb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dzdA (A:)
    metrrirkvlvanrgeiairvfractelgirtvaiyskedvgsyhrykadeaylvgegkk
    pieayldiegiieiakahdvdaihpgygflseniqfakrcreegiifigpnenhldmfgd
    kvkarhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsks
    evkeaferakseakaafgsdevyveklienpkhievqilgdyegnivhlyerdcsvqrrh
    qkvvevapsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqve
    htitemitgidivqsqiliadgcslhshevgipkqediringyaiqsrvttedplnnfmp
    dtgkimayrsgggfgvrldagngfqgavitpyydsllvklstwaltfeqaarkmlrnlre
    frirgiktnipflenvvqhpkflsgeydtsfidttpelfvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dzdA (A:)
    trrirkvlvanrgeiairvfractelgirtvaiyskedvgsyhrykadeaylvgegkkpi
    eayldiegiieiakahdvdaihpgygflseniqfakrcreegiifigpnenhldmfgdkv
    karhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsksev
    keaferakseakaafgsdevyveklienpkhievqilgdyegnivhlyerdcsvqrrhqk
    vvevapsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqveht
    itemitgidivqsqiliadgcslhshevgipkqediringyaiqsrvttedplnnfmpdt
    gkimayrsgggfgvrldagngfqgavitpyydsllvklstwaltfeqaarkmlrnlrefr
    irgiktnipflenvvqhpkflsgeydtsfidttpelfvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dzdB (B:)
    metrrirkvlvanrgeiairvfractelgirtvaiyskedvgsyhrykadeaylvgegkk
    pieayldiegiieiakahdvdaihpgygflseniqfakrcreegiifigpnenhldmfgd
    kvkarhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsks
    evkeaferakseakaafgsdevyveklienpkhievqilgdyegnivhlyerdcsvqrrh
    qkvvevapsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqve
    htitemitgidivqsqiliadgcslhshevgipkqediringyaiqsrvttedplnnfmp
    dtgkimayrsgggfgvrldagngfqgavitpyydsllvklstwaltfeqaarkmlrnlre
    frirgiktnipflenvvqhpkflsgeydtsfidttpelfvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dzdB (B:)
    trrirkvlvanrgeiairvfractelgirtvaiyskedvgsyhrykadeaylvgegkkpi
    eayldiegiieiakahdvdaihpgygflseniqfakrcreegiifigpnenhldmfgdkv
    karhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsksev
    keaferakseakevyveklienpkhievqilgdyegnivhlyerdcsvqrrhqkvvevap
    svslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqvehtitemit
    gidivqsqiliadgcslhshevgipkqediringyaiqsrvttedplnnfmpdtgkimay
    rsgggfgvrldagngfqgavitpyydsllvklstwaltfeqaarkmlrnlrefrirgikt
    nipflenvvqhpkflsgeydtsfidttpelfvf