PDB entry 2dyr

View 2dyr on RCSB PDB site
Description: Bovine heart cytochrome C oxidase at the fully oxidized state
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2006-09-16, released 2007-04-03
The last revision prior to the SCOP 1.75 freeze date was dated 2007-04-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00396 (0-513)
      • modified residue (0)
    Domains in SCOP 1.75: d2dyra1
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68530 (0-226)
      • modified residue (0)
    Domains in SCOP 1.75: d2dyrb1, d2dyrb2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrc1
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrd1
  • Chain 'E':
    Compound: Cytochrome c oxidase polypeptide Va
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyre1
  • Chain 'F':
    Compound: Cytochrome c oxidase polypeptide Vb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrf1
  • Chain 'G':
    Compound: Cytochrome c oxidase polypeptide VIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07471 (0-End)
      • modified residue (10)
    Domains in SCOP 1.75: d2dyrg1
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrh1
  • Chain 'I':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04038 (0-72)
      • modified residue (0)
    Domains in SCOP 1.75: d2dyri1
  • Chain 'J':
    Compound: Cytochrome c oxidase polypeptide VIIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrj1
  • Chain 'K':
    Compound: Cytochrome c oxidase polypeptide VIIb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrk1
  • Chain 'L':
    Compound: Cytochrome c oxidase polypeptide VIIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrl1
  • Chain 'M':
    Compound: Cytochrome c oxidase polypeptide VIII-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrm1
  • Chain 'N':
    Compound: Cytochrome c oxidase subunit 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00396 (0-513)
      • modified residue (0)
    Domains in SCOP 1.75: d2dyrn1
  • Chain 'O':
    Compound: Cytochrome c oxidase subunit 2
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68530 (0-226)
      • modified residue (0)
    Domains in SCOP 1.75: d2dyro1, d2dyro2
  • Chain 'P':
    Compound: Cytochrome c oxidase subunit 3
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrp1
  • Chain 'Q':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrq1
  • Chain 'R':
    Compound: Cytochrome c oxidase polypeptide Va
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrr1
  • Chain 'S':
    Compound: Cytochrome c oxidase polypeptide Vb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrs1
  • Chain 'T':
    Compound: Cytochrome c oxidase polypeptide VIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07471 (0-End)
      • modified residue (10)
    Domains in SCOP 1.75: d2dyrt1
  • Chain 'U':
    Compound: Cytochrome c oxidase subunit VIb isoform 1
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyru1
  • Chain 'V':
    Compound: Cytochrome c oxidase polypeptide VIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04038 (0-72)
      • modified residue (0)
    Domains in SCOP 1.75: d2dyrv1
  • Chain 'W':
    Compound: Cytochrome c oxidase polypeptide VIIa-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrw1
  • Chain 'X':
    Compound: Cytochrome c oxidase polypeptide VIIb
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrx1
  • Chain 'Y':
    Compound: Cytochrome c oxidase polypeptide VIIc
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyry1
  • Chain 'Z':
    Compound: Cytochrome c oxidase polypeptide VIII-heart
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dyrz1
  • Heterogens: DMU, CU, ZN, MG, NA, HEA, CUA, UNX, TGL, PGV, CHD, PSC, PEK, CDL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyrA (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyrB (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dyrC (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrC (C:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dyrD (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrD (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2dyrE (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrE (E:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyrF (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2dyrG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2dyrH (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrH (H:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyrI (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2dyrJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2dyrK (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrK (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2dyrL (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrL (L:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2dyrM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyrN (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyrO (O:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2dyrP (P:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrP (P:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2dyrQ (Q:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrQ (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2dyrR (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrR (R:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyrS (S:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2dyrT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2dyrU (U:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrU (U:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyrV (V:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2dyrW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2dyrX (X:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrX (X:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2dyrY (Y:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrY (Y:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2dyrZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyrZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks