PDB entry 2dyq

View 2dyq on RCSB PDB site
Description: Crystal Structure of the C-terminal Phophotyrosine Interaction Domain of Human APBB3
Class: protein binding
Keywords: Protein binding, Phosphotyrosine-interaction domain (PTB/PID), Alzheimer's disease, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-09-16, released 2007-09-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.256
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 precursor protein-binding family B member 3
    Species: Homo sapiens [TaxId:9606]
    Gene: APBB3, FE65L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2dyqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dyqA (A:)
    gssgssgldavsqaaqkyealymgtlpvtkamgmdvlneaigtltargdrnawvptmlsv
    sdslmtahpiqaeasteeeplwqcpvrlvtfigvgrdphtfgliadlgrqsfqcaafwcq
    phagglseavqaacmvqyqkclva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyqA (A:)
    aqkyealymgtlpvtkamgmdvlneaigtltargdrnawvptmlsvsdslmtahpiqeep
    lwqcpvrlvtfigvgrdphtfgliadlgrqsfqcaafwcqphagglseavqaacmvqyqk
    clva