PDB entry 2dx0

View 2dx0 on RCSB PDB site
Description: Crystal structure of the N-terminal SH2 domain of mouse phospholipase C-gamma 2
Class: hydrolase
Keywords: PHOSPHORIC DIESTER HYDROLASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-08-22, released 2007-09-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase C, gamma 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2dx0a_
  • Chain 'B':
    Compound: Phospholipase C, gamma 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2dx0b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dx0A (A:)
    gssgssgepvqdtpptelhfgekwfhkkvesrtsaekllqeycaetgakdgtflvreset
    fpndytlsfwrsgrvqhcrirstmengvmkyyltdnltfnsiyaliqhyreahlrcaefe
    lrltdpvpnpnpsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dx0A (A:)
    dtpptelhfgekwfhkkvesrtsaekllqeycaetgakdgtflvresetfpndytlsfwr
    sgrvqhcrirstmengvmkyyltdnltfnsiyaliqhyreahlrcaefelrltdpvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dx0B (B:)
    gssgssgepvqdtpptelhfgekwfhkkvesrtsaekllqeycaetgakdgtflvreset
    fpndytlsfwrsgrvqhcrirstmengvmkyyltdnltfnsiyaliqhyreahlrcaefe
    lrltdpvpnpnpsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dx0B (B:)
    saekllqeycaetgakdgtflvresetfdytlsfwrsgrvqhcrirstmengvmkyyltd
    nltfnsiyaliqhyreahlrcaefelrltdpvpnp