PDB entry 2dwx

View 2dwx on RCSB PDB site
Description: Co-crystal Structure Analysis of GGA1-GAE with the WNSF motif
Class: protein transport
Keywords: ig fold, adaptin, protein transport
Deposited on 2006-08-21, released 2007-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.241
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dwxa_
  • Chain 'B':
    Compound: ADP-ribosylation factor-binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dwxb_
  • Chain 'C':
    Compound: ADP-ribosylation factor-binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dwxc_
  • Chain 'D':
    Compound: ADP-ribosylation factor-binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dwxd_
  • Chain 'P':
    Compound: hinge peptide from ADP-ribosylation factor binding protein GGA1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: hinge peptide from ADP-ribosylation factor binding protein GGA1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dwxA (A:)
    ikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpk
    vmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgd
    vdqfpppetwgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dwxA (A:)
    nilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkvmkv
    klqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdvdqf
    pppetwgsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dwxB (B:)
    ikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpk
    vmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgd
    vdqfpppetwgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dwxB (B:)
    ilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavvklqpps
    gtelpafnpivhpsaitqvlllanpqkerykltftmgdqtynemgdvdqfpppetwgsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dwxC (C:)
    ikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpk
    vmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgd
    vdqfpppetwgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dwxC (C:)
    ilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkvmkvk
    lqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdvdqfp
    ppetwgsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dwxD (D:)
    ikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpk
    vmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgd
    vdqfpppetwgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dwxD (D:)
    nilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkvmkv
    klqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdvdqf
    pppetwgsl
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.