PDB entry 2dws

View 2dws on RCSB PDB site
Description: Cu-containing nitrite reductase at pH 8.4 with bound nitrite
Class: oxidoreductase
Keywords: copper protein, cupredoxin, denitrification, OXIDOREDUCTASE
Deposited on 2006-08-16, released 2006-12-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.168
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: nirK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53239 (0-327)
      • see remark 999 (186)
      • see remark 999 (237)
      • see remark 999 (275)
      • see remark 999 (307)
      • see remark 999 (323-324)
    Domains in SCOPe 2.05: d2dwsa1, d2dwsa2
  • Heterogens: CU, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dwsA (A:)
    lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl
    mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf
    vyhcapggpmipwhvvsgmagcimvlprdglkdhegkpvrydtvyyigesdhyipkdedg
    tymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhsqpnrd
    srphligghgdlvwetgkfhnaperdletwfirggsagaalykflqpgvyayvnhnliea
    vhkgatahvlvegewdndlmeqvvapvg