PDB entry 2dwr

View 2dwr on RCSB PDB site
Description: Crystal structure of the human Wa rotavirus VP8* carbohydrate-recognising domain
Class: viral protein
Keywords: beta-sandwich, VIRAL PROTEIN
Deposited on 2006-08-16, released 2007-04-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86202 (0-159)
      • engineered (99)
    Domains in SCOPe 2.04: d2dwra_
  • Heterogens: GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dwrA (A:)
    mldgpyqpttftppndywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytifg
    eskqfnvsndsnkwkflemfrsssqnefynrrtltsdtrlvgilkyggrvwtfhgetpra
    ttdssstanlnnisitihsefyiiprsqeskcneyinngl