PDB entry 2dvl

View 2dvl on RCSB PDB site
Description: Crystal structure of project TT0160 from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2006-07-31, released 2007-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dvla1, d2dvla2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dvlb1, d2dvlb2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dvlA (A:)
    mtltqeqrlvldavrrvarevlyplapeydrkaeypwpqlkalaelgllgmttpeewggv
    gldsvtwalaleelaaadpsvavivsvtsglpqymllrfgseaqkrrylvplargewiga
    fcltepqagsdakslraearrvkggfvlngvkswitsaghahlyvvmartekgisaflve
    kgtpglsfgrpeekmglhaahtaevrleevfvpeenllgeegrglayalagldsgrvgva
    aqavgiargafeiakayaeereqfgkklkehqaiafkiadmhvkiaaaralvleaarkkd
    rgerftleasaaklfasaaavevtreavqvlggygyhrdyrveryyrdakvteiyegtse
    iqrlviarelyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvlA (A:)
    ltqeqrlvldavrrvarevlyplapeydrkaeypwpqlkalaelgllgmttpeewggvgl
    dsvtwalaleelaaadpsvavivsvtsglpqymllrfgseaqkrrylvplargewigafc
    ltepqagsdakslraearrvkggfvlngvkswitsaghahlyvvmartekgisaflvekg
    tpglsfgrpeekmglhaahtaevrleevfvpeenllgeegrglayalagldsgrvgvaaq
    avgiargafeiakayaeereqfgkklkehqaiafkiadmhvkiaaaralvleaarkkdrg
    erftleasaaklfasaaavevtreavqvlggygyhrdyrveryyrdakvteiyegtseiq
    rlviarelyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dvlB (B:)
    mtltqeqrlvldavrrvarevlyplapeydrkaeypwpqlkalaelgllgmttpeewggv
    gldsvtwalaleelaaadpsvavivsvtsglpqymllrfgseaqkrrylvplargewiga
    fcltepqagsdakslraearrvkggfvlngvkswitsaghahlyvvmartekgisaflve
    kgtpglsfgrpeekmglhaahtaevrleevfvpeenllgeegrglayalagldsgrvgva
    aqavgiargafeiakayaeereqfgkklkehqaiafkiadmhvkiaaaralvleaarkkd
    rgerftleasaaklfasaaavevtreavqvlggygyhrdyrveryyrdakvteiyegtse
    iqrlviarelyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvlB (B:)
    ltqeqrlvldavrrvarevlyplapeydrkaeypwpqlkalaelgllgmttpeewggvgl
    dsvtwalaleelaaadpsvavivsvtsglpqymllrfgseaqkrrylvplargewigafc
    ltepqagsdakslraearrvkggfvlngvkswitsaghahlyvvmartekgisaflvekg
    tpglsfgrpeekmglhaahtaevrleevfvpeenllgeegrglayalagldsgrvgvaaq
    avgiargafeiakayaeereqfgkklkehqaiafkiadmhvkiaaaralvleaarkkdrg
    erftleasaaklfasaaavevtreavqvlggygyhrdyrveryyrdakvteiyegtseiq
    rlviarelyr