PDB entry 2dvh

View 2dvh on RCSB PDB site
Description: the y64a mutant of cytochrome c553 from desulfovibrio vulgaris hildenborough, nmr, 39 structures
Class: electron transport
Keywords: electron transport, cytochrome c, heme
Deposited on 1998-03-25, released 1998-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-04.
Experiment type: NMR39
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c-553
  Species: Desulfovibrio vulgaris
  Gene: M13CYF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04032 (0-78)
    • engineered (63)
  Domains in SCOP 1.75: d2dvha_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dvhA (A:)
  adgaalykscigchgadgskaamgsakpvkgqgaeelykkmkgyadgsyggerkammtna
  vkkasdeelkaladymskl