PDB entry 2dvh

View 2dvh on RCSB PDB site
Description: the y64a mutant of cytochrome c553 from desulfovibrio vulgaris hildenborough, nmr, 39 structures
Deposited on 1998-03-25, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: NMR39
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2dvh__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dvh_ (-)
  adgaalykscigchgadgskaamgsakpvkgqgaeelykkmkgyadgsyggerkammtna
  vkkasdeelkaladymskl