PDB entry 2dv1

View 2dv1 on RCSB PDB site
Description: Crystal structure of D141E mutant of BpKatG
Class: oxidoreductase
Keywords: KatG, catalase-peroxidase, compound I, OXIDOREDUCTASE
Deposited on 2006-07-28, released 2006-11-07
Made obsolete by 5sx1 on 2016-09-07

The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase/catalase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939D2 (Start-747)
      • engineered (140)
    Domains in SCOPe 2.06: d2dv1a1, d2dv1a2
  • Chain 'B':
    Compound: Peroxidase/catalase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939D2 (Start-747)
      • engineered (140)
    Domains in SCOPe 2.06: d2dv1b1, d2dv1b2
  • Heterogens: NA, PO4, HEM, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dv1A (A:)
    mpgsdagprrrgvheqrrnrmsneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsd
    pmgkdfnyaqafekldlaavkrdlhalmttsqdwwpadfghygglfirmawhsagtyrta
    dgrggagegqqrfaplnswpenanldkarrllwpikqkygraiswadlliltgnvalesm
    gfktfgfaggradtwepedvywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvn
    pegpdgnpdpvaaardirdtfarmamndeetvaliagghtfgkthgagpasnvgaepeaa
    gieaqglgwksayrtgkgadaitsglevtwtttptqwshnffenlfgyeweltkspagah
    qwvakgadavipdafdpskkhrptmlttdlslrfdpayekisrrfhenpeqfadafaraw
    fklthrdmgprarylgpevpaevllwqdpipavdhplidaadaaelkakvlasgltvsql
    vstawaaastfrgsdkrggangarirlapqkdweanqpeqlaavletleairtafngaqr
    ggkqvsladlivlagcagveqaaknaghavtvpfapgradasqeqtdvesmavlepvadg
    frnylkgkyrvpaevllvdkaqlltlsapemtvllgglrvlganvgqsrhgvftareqal
    tndffvnlldmgtewkptaadadvfegrdratgelkwtgtrvdlvfgshsqlralaevyg
    sadaqekfvrdfvavwnkvmnldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dv1A (A:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpenanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dv1B (B:)
    mpgsdagprrrgvheqrrnrmsneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsd
    pmgkdfnyaqafekldlaavkrdlhalmttsqdwwpadfghygglfirmawhsagtyrta
    dgrggagegqqrfaplnswpenanldkarrllwpikqkygraiswadlliltgnvalesm
    gfktfgfaggradtwepedvywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvn
    pegpdgnpdpvaaardirdtfarmamndeetvaliagghtfgkthgagpasnvgaepeaa
    gieaqglgwksayrtgkgadaitsglevtwtttptqwshnffenlfgyeweltkspagah
    qwvakgadavipdafdpskkhrptmlttdlslrfdpayekisrrfhenpeqfadafaraw
    fklthrdmgprarylgpevpaevllwqdpipavdhplidaadaaelkakvlasgltvsql
    vstawaaastfrgsdkrggangarirlapqkdweanqpeqlaavletleairtafngaqr
    ggkqvsladlivlagcagveqaaknaghavtvpfapgradasqeqtdvesmavlepvadg
    frnylkgkyrvpaevllvdkaqlltlsapemtvllgglrvlganvgqsrhgvftareqal
    tndffvnlldmgtewkptaadadvfegrdratgelkwtgtrvdlvfgshsqlralaevyg
    sadaqekfvrdfvavwnkvmnldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dv1B (B:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpenanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla