PDB entry 2dtq

View 2dtq on RCSB PDB site
Description: Crystal Structure of the Fucosylated Fc Fragment from Human Immunoglobulin G1
Class: immune system
Keywords: Immunoglobulin, IgG1
Deposited on 2006-07-14, released 2007-03-13
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dtqa1, d2dtqa2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dtqb1, d2dtqb2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dtqA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dtqA (A:)
    llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpre
    eqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlpp
    srdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvd
    ksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dtqB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dtqB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls