PDB entry 2dtg

View 2dtg on RCSB PDB site
Description: Insulin receptor (IR) ectodomain in complex with fab's
Class: hormone receptor/immune system
Keywords: insulin receptor; ir ectodomain; x-ray crystallography, hormone receptor/immune system complex
Deposited on 2006-07-12, released 2006-09-19
Made obsolete by 4zxb on 2016-02-24

The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.251
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab 83-7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2DTG (0-219)
    Domains in SCOPe 2.06: d2dtga1
  • Chain 'B':
    Compound: fab 83-7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2DTG (0-218)
    Domains in SCOPe 2.06: d2dtgb1, d2dtgb2
  • Chain 'C':
    Compound: fab 83-14 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2DTG (0-214)
    Domains in SCOPe 2.06: d2dtgc1, d2dtgc2
  • Chain 'D':
    Compound: fab 83-14 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2DTG (0-213)
    Domains in SCOPe 2.06: d2dtgd1
  • Chain 'E':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213
      • engineered (143)
      • see remark 999 (841-842)
    Domains in SCOPe 2.06: d2dtge1, d2dtge2, d2dtge3, d2dtge4, d2dtge5, d2dtge6

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dtgA (A:)
    qvqlkesgpglvapsqslsitctvsgfpltaygvnwvrqppgkglewlgmiwgdgntdyn
    salksrlsiskdnsksqvflkmnslqtddtaryycardpygskpmdywgqgtsvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dtgB (B:)
    divmsqspsslvvsvgekvtmsckssqsllyssnqknflawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyfryrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrgec
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dtgC (C:)
    qvqlqqsgpelvkpgalvkisckasgytftnydihwvkqrpgqglewigwiypgdgstky
    nekfkgkatltadkssstaymhlssltseksavyfcarewaywgqgtlvtvsaakttaps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dtgD (D:)
    diqmtqspsslsaslgervsltcrasqdiggnlywlqqgpdgtikrliyatssldpgvpk
    rfsgsrsgsdysltisslksedfvdyyclqyssspwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrgec
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2dtgE (E:)
    hlypgevcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdy
    lllfrvygleslkdlfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrie
    knnelcylatidwsrildsvednhivlnkddneecgdicpgtakgktncpatvingqfve
    rcwthshcqkvcptickshgctaeglcchseclgncsqpddptkcvacrnfyldgrcvet
    cpppyyhfqdwrcvnfsfcqdlhhkcknsrrqgchqyvihnnkcipecpsgytmnssnll
    ctpclgpcpkvchllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlgl
    ieeisgylkirrsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnlt
    itqgklffhynpklclseihkmeevsgtkgrqerndialktngdqascenellkfsyirt
    sfdkillrwepywppdfrdllgfmlfykeapyqnvtefdgqdacgsnswtvvdidpplrs
    ndpksqnhpgwlmrglkpwtqyaifvktlvtfsderrtygaksdiiyvqtdatnpsvpld
    pisvsnsssqiilkwkppsdpngnithylvfwerqaedselfeldyclkglklpsrtwsp
    pfesedsqkhnqseyedsageccscpktdsqilkeleessfrktfedylhnvvfvprpsr
    krrslgdvgnagnneehrpfekvvnkeslvisglrhftgyrielqacnqdtpeercsvaa
    yvsartmpeakaddivgpvtheifennvvhlmwqepkepnglivlyevsyrrygdeelhl
    cdtrkhfalergcrlrglspgnysvriratslagngswteptyfyvtdyldvpsnia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dtgE (E:)
    pgevcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdylll
    frvygleslkdlfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrieknn
    elcylatidwsrildsvednhivlnkddneecgdicpgtakgktncpatvingqfvercw
    thshcqkvcptickshgctaeglcchseclgncsqpddptkcvacrnfyldgrcvetcpp
    pyyhfqdwrcvnfsfcqdlhhkcknsrrqgchqyvihnnkcipecpsgytmnssnllctp
    clgpcpkvchllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlgliee
    isgylkirrsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnltitq
    gklffhynpklclseihkmeevsgtkgrqerndialktngdqascenellkfsyirtsfd
    killrwepywppdfrdllgfmlfykeapyqnvtefdgqdacgsnswtvvdidpplrsndp
    ksqnhpgwlmrglkpwtqyaifvktlvtfsderrtygaksdiiyvqtdatnpsvpldpis
    vsnsssqiilkwkppsdpngnithylvfwerqaedselfeldyclkglklpsehrpfekv
    vnkeslvisglrhftgyrielqacnqdtpeercsvaayvsartmpeakaddivgpvthei
    fennvvhlmwqepkepnglivlyevsyrrygdeelhlcdtrkhfalergcrlrglspgny
    svriratslagngswteptyfyvtdyl