PDB entry 2dtg

View 2dtg on RCSB PDB site
Description: Insulin receptor (IR) ectodomain in complex with fab's
Class: hormone receptor/immune system
Keywords: insulin receptor; ir ectodomain; x-ray crystallography
Deposited on 2006-07-12, released 2006-09-19
Made obsolete by 4zxb on 2016-02-24

The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.261
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab 83-7 heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d2dtga1
  • Chain 'B':
    Compound: fab 83-7 light chain
    Species: MUS MUSCULUS
  • Chain 'C':
    Compound: fab 83-14 heavy chain
    Species: MUS MUSCULUS
  • Chain 'D':
    Compound: fab 83-14 light chain
    Species: MUS MUSCULUS
  • Chain 'E':
    Compound: Insulin receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213
      • engineered (143)
      • see remark 999 (841-842)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dtgA (A:)
    qvqlkesgpglvapsqslsitctvsgfpltaygvnwvrqppgkglewlgmiwgdgntdyn
    salksrlsiskdnsksqvflkmnslqtddtaryycardpygskpmdywgqgtsvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.