PDB entry 2drw

View 2drw on RCSB PDB site
Description: The crystal structutre of D-amino acid amidase from Ochrobactrum anthropi SV3
Class: hydrolase
Keywords: penicillin recognizing protein, D-stereospecific, amidase, hydrophobic, hydrolase
Deposited on 2006-06-15, released 2006-07-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2drwa1
  • Chain 'B':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2drwb_
  • Chain 'C':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2drwc_
  • Chain 'D':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2drwd_
  • Chain 'E':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2drwe_
  • Chain 'F':
    Compound: D-amino acid amidase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2drwf_
  • Heterogens: BA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2drwA (A:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2drwA (A:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
    agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
    selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
    rs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2drwB (B:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2drwB (B:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
    agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
    selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
    rs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2drwC (C:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2drwC (C:)
    dlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasct
    ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
    kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
    mkdtwvgthetfpiereargymhadenpqwdvsgagdpvdgvwdstewfplsganaagdm
    vstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselk
    ghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2drwD (D:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2drwD (D:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
    tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
    dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
    gmkdtwvgthetfpiereargymhaaagdpvdgvwdstewfplsganaagdmvstprdiv
    kflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipg
    htsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2drwE (E:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2drwE (E:)
    sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadknkmpmtgdhlfriasct
    ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
    kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
    mkdtwvgthetfpiereargymhapvdgvwdstewfplsganaagdmvstprdivkflna
    lfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygsselkghlgqipghtsim
    grdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2drwF (F:)
    msdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfrias
    ctksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmi
    sdkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifap
    lgmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgan
    aagdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmryg
    sselkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikn
    srs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2drwF (F:)
    aiqgilddhvargvvgvslalclpgeetslyqsgyadkmpmtgdhlfriasctksfiatg
    lhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisdkswtaqe
    ivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplgmkdtwvg
    thetfpiereargymhwdstewfplsganaagdmvstprdivkflnalfdgrildqkrlw
    emkdnikpaffpgsntvanghglllmrygsselkghlgqipghtsimgrdeetgaalmli
    qnsgagdfesfylkgvnepvdrvleai