PDB entry 2drk

View 2drk on RCSB PDB site
Description: Acanthamoeba myosin I SH3 domain bound to Acan125
Class: contractile protein
Keywords: SH3 domain, CONTRACTILE PROTEIN
Deposited on 2006-06-09, released 2007-05-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.159
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin heavy chain IB
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19706 (5-58)
      • cloning artifact (0-4)
    Domains in SCOPe 2.06: d2drka1, d2drka2
  • Chain 'B':
    Compound: 10-mer peptide from Myosin-I binding protein Acan125
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2drkA (A:)
gspgiqvkalydydaqtgdeltfkegdtiivhqkdpagwwegelngkrgwvpanyvqdi

  • Chain 'B':
    No sequence available.