PDB entry 2dqx

View 2dqx on RCSB PDB site
Description: mutant beta-amylase (W55R) from soy bean
Class: hydrolase
Keywords: amylase mutant sliding soy bean, HYDROLASE
Deposited on 2006-06-01, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q42795 (Start-494)
      • engineered (54)
    Domains in SCOPe 2.07: d2dqxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dqxA (A:)
    atsdsnmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvrwgiie
    lkgpkqydwrayrslfqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhd
    ifytnrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievg
    lgpagelrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkynd
    vpestgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgih
    wwykvenhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpq
    elvqqvlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylr
    lsddllqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkpt
    lpfpwlpetdmkvdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqxA (A:)
    snmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvrwgiielkgp
    kqydwrayrslfqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifyt
    nrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpa
    gelrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpes
    tgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwyk
    venhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvq
    qvlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsdd
    llqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfp
    wlpetdmkvdg