PDB entry 2dpx

View 2dpx on RCSB PDB site
Description: Crystal Structure of human Rad GTPase
Class: signaling protein
Keywords: rad, gtpase, small-g, rgk, signal transduction, diabetes, signaling protein
Deposited on 2006-05-18, released 2006-08-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein RAD
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAD, RAD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2dpxa_
  • Chain 'B':
    Compound: GTP-binding protein RAD
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAD, RAD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2dpxb_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dpxA (A:)
    gvsdesvykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvyd
    iweqdggrwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnk
    sdlvrsrevsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrrdsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dpxA (A:)
    svykvlllgapgvgksalarifggvehtydrsivvdgeeaslmvydiwlpghcmamgday
    vivysvtdkgsfekaselrvqlrrardvpiilvgnksdlvrsrevsvdegracavvfdck
    fietsaalhhnvqalfegvvrqirlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dpxB (B:)
    gvsdesvykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvyd
    iweqdggrwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnk
    sdlvrsrevsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrrdsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dpxB (B:)
    ykvlllgapgvgksalarifggvehtydrsivvdgeeaslmvydiwmgdayvivysvtdk
    gsfekaselrvqlrravpiilvgnksdlvrsrevsvdegracavvfdckfietsaalhhn
    vqalfegvvrqirlr