PDB entry 2doq

View 2doq on RCSB PDB site
Description: crystal structure of Sfi1p/Cdc31p complex
Class: Cell Cycle
Keywords: Sfi1p, centrin, cdc31p, spindle pole body, centrosome, Cell Cycle
Deposited on 2006-05-03, released 2006-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.261
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC31
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06704
      • modified residue (33)
      • modified residue (48)
      • modified residue (75)
      • modified residue (84)
      • modified residue (136)
    Domains in SCOPe 2.06: d2doqa_
  • Chain 'B':
    Compound: Cell division control protein 31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC31
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06704 (Start-160)
      • modified residue (33)
      • modified residue (48)
      • modified residue (75)
      • modified residue (84)
      • modified residue (136)
    Domains in SCOPe 2.06: d2doqb_
  • Chain 'C':
    Compound: Cell division control protein 31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC31
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06704
      • modified residue (33)
      • modified residue (48)
      • modified residue (75)
      • modified residue (84)
      • modified residue (136)
    Domains in SCOPe 2.06: d2doqc_
  • Chain 'D':
    Compound: SFI1p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SFI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12369 (5-End)
      • cloning artifact (1-4)
      • modified residue (37)
      • see remark 999 (65)
      • modified residue (80)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2doqA (A:)
    msknrsslqsgplnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkre
    ildlideydsegrhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrr
    vakelgetltdeelramieefdldgdgeinenefiaictds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2doqA (A:)
    selleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydsegrh
    lmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltdeel
    ramieefdldgdgeinenefiaictd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2doqB (B:)
    msknrsslqsgplnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkre
    ildlideydsegrhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrr
    vakelgetltdeelramieefdldgdgeinenefiaictds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2doqB (B:)
    lnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydseg
    rhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltde
    elramieefdldgdgeinenefiaictds
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2doqC (C:)
    msknrsslqsgplnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkre
    ildlideydsegrhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrr
    vakelgetltdeelramieefdldgdgeinenefiaictds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2doqC (C:)
    nselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydsegr
    hlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgamieefd
    ldnenefiai
    

  • Chain 'D':
    No sequence available.