PDB entry 2doa

View 2doa on RCSB PDB site
Description: Solution structure of the helical domain in human Eleven-nineteen lysine-rich leukemia protein ELL
Class: transcription
Keywords: elongation factor, C19orf17, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-04-28, released 2007-05-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II elongation factor ELL
    Species: Homo sapiens [TaxId:9606]
    Gene: ELL, C19orf17
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55199 (5-97)
      • cloning artifact (0-4)
      • cloning artifact (98-103)
    Domains in SCOPe 2.05: d2doaa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2doaA (A:)
    gssgssgvsqrpfrdrvlhllalrpyrkaelllrlqkdgltqadkdaldgllqqvanmsa
    kdgtctlqdcmykdvqkdwpgysegdqqllkrvlvrklsgpssg