PDB entry 2dnp

View 2dnp on RCSB PDB site
Description: Solution structure of RNA binding domain 2 in RNA-binding protein 14
Class: transcription
Keywords: RRM domain, RBD, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-04-26, released 2006-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 14
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96PK6 (7-83)
      • cloning artifact (0-6)
      • cloning artifact (84-89)
    Domains in SCOPe 2.07: d2dnpa1, d2dnpa2, d2dnpa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dnpA (A:)
    gssgssgntwkifvgnvsaactsqelrslferrgrviecdvvkdyafvhmekeadakaai
    aqlngkevkgkrinvelstkgqkksgpssg