PDB entry 2dnh

View 2dnh on RCSB PDB site
Description: Solution structure of RNA binding domain in Bruno-like 5 RNA binding protein
Class: RNA binding protein
Keywords: RRM domain, RBD, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-04-26, released 2006-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bruno-like 5, RNA binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Brunol5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86VW6 (7-98)
      • cloning artifact (0-6)
      • cloning artifact (99-104)
    Domains in SCOPe 2.08: d2dnha1, d2dnha2, d2dnha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dnhA (A:)
gssgssgsesrggrdrklfvgmlnkqqseedvlrlfqpfgvidectvlrgpdgsskgcaf
vkfsshteaqaaihalhgsqtmpgassslvvkfadtdkesgpssg