PDB entry 2dng

View 2dng on RCSB PDB site
Description: Solution structure of RNA binding domain in Eukaryotic translation initiation factor 4H
Class: translation
Keywords: RRM domain, RBD, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSLATION
Deposited on 2006-04-26, released 2006-10-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 4H
    Species: Mus musculus [TaxId:10090]
    Gene: Wbscr1, Eif4h
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUK2 (7-96)
      • cloning artifact (0-6)
      • cloning artifact (97-102)
    Domains in SCOPe 2.04: d2dnga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dngA (A:)
    gssgssgkelpteppytayvgnlpfntvqgdidaifkdlsirsvrlvrdkdtdkfkgfcy
    vefdevdslkealtydgallgdrslrvdiaegrkqdksgpssg